PDB entry 1ng3

View 1ng3 on RCSB PDB site
Description: complex of thio (glycine oxidase) with acetyl-glycine
Deposited on 2002-12-16, released 2003-04-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ng3A (A:)
    mghhhhhhhhhhssghiegrhmkrhyeavvigggiigsaiayylakenkntalfesgtmg
    grttsaaagmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfkla
    fseedvlqlrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvk
    aakmlgaeifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaf
    lpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvm
    kkaktmlppiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatg
    alisdlimnkevnqdwlhafridrkeavqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng3A (A:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlppiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ng3B (B:)
    mghhhhhhhhhhssghiegrhmkrhyeavvigggiigsaiayylakenkntalfesgtmg
    grttsaaagmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfkla
    fseedvlqlrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvk
    aakmlgaeifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaf
    lpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvm
    kkaktmlppiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatg
    alisdlimnkevnqdwlhafridrkeavqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng3B (B:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlppiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk