PDB entry 1ng1

View 1ng1 on RCSB PDB site
Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
Deposited on 1998-04-30, released 1999-07-30
The last revision prior to the SCOP 1.67 freeze date was dated 2000-03-13, with a file datestamp of 2000-03-13.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ng1_ (-)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm