PDB entry 1ng1

View 1ng1 on RCSB PDB site
Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
Class: signal recognition
Keywords: ffh, srp, gtpase, signal recognition particle, GDP, mg
Deposited on 1998-04-30, released 1999-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal sequence recognition protein ffh
    Species: Thermus aquaticus [TaxId:271]
    Gene: FFH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ng1a1, d1ng1a2
  • Heterogens: CD, MG, GDP, EDO, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ng1A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm