PDB entry 1nfv

View 1nfv on RCSB PDB site
Description: X-ray structure of Desulfovibrio desulfuricans bacterioferritin: the diiron centre in different catalytic states (as-isolated structure)
Class: iron storage/electron transport
Keywords: bacterioferritin, 24 subunits in the active molecule, diiron centre, haem Fe-coproporphyrin III cofactor, IRON STORAGE-ELECTRON TRANSPORT COMPLEX
Deposited on 2002-12-16, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfva_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfve_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvi_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvk_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvl_
  • Chain 'M':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvm_
  • Chain 'N':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvn_
  • Chain 'O':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvo_
  • Chain 'P':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOPe 2.07: d1nfvp_
  • Heterogens: FE, SO4, GOL, FEC, 3PY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfvA (A:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvA (A:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nfvB (B:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvB (B:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nfvC (C:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvC (C:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nfvD (D:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvD (D:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nfvE (E:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvE (E:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nfvF (F:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvF (F:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nfvG (G:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvG (G:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nfvH (H:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvH (H:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1nfvI (I:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvI (I:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1nfvJ (J:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvJ (J:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1nfvK (K:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvK (K:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nfvL (L:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvL (L:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1nfvM (M:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvM (M:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nfvN (N:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvN (N:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1nfvO (O:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvO (O:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1nfvP (P:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfvP (P:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv