PDB entry 1nft

View 1nft on RCSB PDB site
Description: ovotransferrin, n-terminal lobe, iron loaded open form
Class: transport protein
Keywords: transferrin, ovotransferrin, iron binding protein, transport protein
Deposited on 1999-01-07, released 1999-01-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ovotransferrin)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02789 (0-328)
      • conflict (8)
      • conflict (60)
      • conflict (129)
    Domains in SCOPe 2.04: d1nfta_
  • Heterogens: SO4, FE, NTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nftA (A:)
    ksvirwctvsspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggq
    vfeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsa
    gwnipigtlihrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkca
    rnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcn
    warvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkds
    aimlkrvpslmdsqlylgfeyysaiqsmr