PDB entry 1nfr

View 1nfr on RCSB PDB site
Description: Rv2002 gene product from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: Directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2002-12-16, released 2002-12-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • modified residue (18)
      • modified residue (26)
      • engineered (46)
      • engineered (68)
      • modified residue (126)
      • modified residue (189)
    Domains in SCOP 1.75: d1nfra_
  • Chain 'B':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • modified residue (18)
      • modified residue (26)
      • engineered (46)
      • engineered (68)
      • modified residue (126)
      • modified residue (189)
    Domains in SCOP 1.75: d1nfrb_
  • Chain 'C':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • modified residue (18)
      • modified residue (26)
      • engineered (46)
      • engineered (68)
      • modified residue (126)
      • modified residue (189)
    Domains in SCOP 1.75: d1nfrc_
  • Chain 'D':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • modified residue (18)
      • modified residue (26)
      • engineered (46)
      • engineered (68)
      • modified residue (126)
      • modified residue (189)
    Domains in SCOP 1.75: d1nfrd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfrA (A:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfrA (A:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nfrB (B:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfrB (B:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nfrC (C:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfrC (C:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nfrD (D:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfrD (D:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn