PDB entry 1nfq

View 1nfq on RCSB PDB site
Description: Rv2002 gene product from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: Directed evolution, SDR, GFP, hydroxysteroid dehydrogenase, structural genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2002-12-15, released 2002-12-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.162
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • engineered (46)
      • engineered (68)
    Domains in SCOP 1.75: d1nfqa_
  • Chain 'B':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • engineered (46)
      • engineered (68)
    Domains in SCOP 1.75: d1nfqb_
  • Chain 'C':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • engineered (46)
      • engineered (68)
    Domains in SCOP 1.75: d1nfqc_
  • Chain 'D':
    Compound: Putative oxidoreductase Rv2002
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69167
      • engineered (5)
      • engineered (46)
      • engineered (68)
    Domains in SCOP 1.75: d1nfqd_
  • Heterogens: NAI, AE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfqA (A:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfqA (A:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nfqB (B:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfqB (B:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nfqC (C:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfqC (C:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nfqD (D:)
    msgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhl
    dvtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgi
    ravvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvns
    ihpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtva
    glahndfgavevssqpewvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfqD (D:)
    sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
    vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
    avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
    hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
    lahn