PDB entry 1nfp

View 1nfp on RCSB PDB site
Description: structural refinement of the non-fluorescent flavoprotein from photobacterium leiognathi at 1.60 angstroms resolution
Class: flavoprotein
Keywords: flavin mononucleotide, myristate, flavoprotein
Deposited on 1995-02-27, released 1995-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: luxf gene product
  Species: Photobacterium leiognathi [TaxId:658]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09142 (0-227)
    • conflict (73)
    • conflict (122)
  Domains in SCOPe 2.08: d1nfpa_
• Heterogens: SO4, FMN, MYR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nfpA (A:)
  mtkwnygvfflnfyhvgqqepsltmsnaletlriidedtsiydvvafsehhidksyndet
  klapfvslgkqihvlatspetvvkaakygmpllfkwddsqqkriellnhyqaaaakfnvd
  ianvrhrlmlfvnvndnptqakaelsiyledylsytqaetsideiinsnaagnfdtclhh
  vaemaqglnnkvdflfcfesmkdqenkkslminfdkrvinyrkehnln