PDB entry 1nfo

View 1nfo on RCSB PDB site
Description: apolipoprotein e2 (apoe2, d154a mutation)
Class: lipid transport
Keywords: lipid transport, heparin-binding, plasma protein, hdl, vldl
Deposited on 1996-07-17, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein e2
    Species: Homo sapiens [TaxId:9606]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02649
      • engineered (153)
      • conflict (157)
    Domains in SCOPe 2.07: d1nfoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfoA (A:)
    kveqavetepepelrqqtewqsgqrwelalgrfwdylrwvqtlseqvqeellssqvtqel
    ralmdetmkelkaykseleeqltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrg
    evqamlgqsteelrvrlashlrklrkrllrdadalqkclavyqagaregaerglsairer
    lgplveqgrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfoA (A:)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqr
    lskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrda
    dalqkclavyq