PDB entry 1nfo

View 1nfo on RCSB PDB site
Description: apolipoprotein e2 (apoe2, d154a mutation)
Deposited on 1996-07-17, released 1997-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1nfo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1nfo_ (-)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
    tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
    klrkrllrdadalqkclavyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfo_ (-)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqr
    lskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrda
    dalqkclavyq