PDB entry 1nfn

View 1nfn on RCSB PDB site
Description: apolipoprotein e3 (apoe3)
Class: lipid transport
Keywords: lipid transport, heparin-binding, plasma protein, hdl, vldl
Deposited on 1996-07-17, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.213
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein e3
    Species: Homo sapiens [TaxId:9606]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nfna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfnA (A:)
    kveqavetepepelrqqtewqsgqrwelalgrfwdylrwvqtlseqvqeellssqvtqel
    ralmdetmkelkaykseleeqltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrg
    evqamlgqsteelrvrlashlrklrkrllrdaddlqkrlavyqagaregaerglsairer
    lgplveqgrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfnA (A:)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqr
    lskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrda
    ddlqkrlavyqa