PDB entry 1nfj

View 1nfj on RCSB PDB site
Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding
Class: gene regulation
Keywords: Sir2, alba, HDAC, gene regulation, transcription
Deposited on 2002-12-15, released 2003-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein AF1956
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nfja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfjA (A:)
    maehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkv
    keikidteeleseqgrrsnvstieivlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfjA (A:)
    ehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvke
    ikidteeleseqgrrsnvstieivlak