PDB entry 1nfh

View 1nfh on RCSB PDB site
Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding
Deposited on 2002-12-15, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nfha_
  • Chain 'B':
    Domains in SCOP 1.67: d1nfhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfhA (A:)
    maehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkv
    keikidteeleseqgrrsnvstieivlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfhA (A:)
    hvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvkei
    kidteeleseqgrrsnvstieivlak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nfhB (B:)
    maehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkv
    keikidteeleseqgrrsnvstieivlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfhB (B:)
    hvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvkei
    kidteeleseqgrrsnvstieivlak