PDB entry 1nfd

View 1nfd on RCSB PDB site
Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Class: complex (immunoreceptor/immunoglobulin)
Keywords: COMPLEX (IMMUNORECEPTOR-IMMUNOGLOBULIN), COMPLEX (IMMUNORECEPTOR-IMMUNOGLOBULIN) complex
Deposited on 1997-08-04, released 1998-01-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n15 alpha-beta T-cell receptor
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed):
    • PDB 1NFD (0-202)
    Domains in SCOPe 2.04: d1nfda1, d1nfda2
  • Chain 'B':
    Compound: n15 alpha-beta T-cell receptor
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nfdb1, d1nfdb2
  • Chain 'C':
    Compound: n15 alpha-beta T-cell receptor
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed):
    • PDB 1NFD (0-202)
    Domains in SCOPe 2.04: d1nfdc1, d1nfdc2
  • Chain 'D':
    Compound: n15 alpha-beta T-cell receptor
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nfdd1, d1nfdd2
  • Chain 'E':
    Compound: h57 fab
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed):
    • PDB 1NFD (0-211)
    Domains in SCOPe 2.04: d1nfde1, d1nfde2
  • Chain 'F':
    Compound: h57 fab
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed):
    • PDB 1NFD (0-221)
    Domains in SCOPe 2.04: d1nfdf1, d1nfdf2
  • Chain 'G':
    Compound: h57 fab
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed):
    • PDB 1NFD (0-211)
    Domains in SCOPe 2.04: d1nfdg1, d1nfdg2
  • Chain 'H':
    Compound: h57 fab
    Species: Mus musculus [TaxId:10090]
    Gene: N15 T-CELL RECEPTOR
    Database cross-references and differences (RAF-indexed):
    • PDB 1NFD (0-221)
    Domains in SCOPe 2.04: d1nfdh1, d1nfdh2
  • Heterogens: NAG, NDG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdA (A:)
    dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
    gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviahiqnpepa
    vyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksngaiawsnq
    tsftcqdifketnatypssdvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdB (B:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdC (C:)
    dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
    gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviahiqnpepa
    vyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksngaiawsnq
    tsftcqdifketnatypssdvpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdD (D:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdE (E:)
    yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf
    sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlrgpksspkvtvfp
    pspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskqgqnymtssylsl
    tadqwkshnrvscqvthegetvekslspaecl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdF (F:)
    evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
    eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
    atttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlh
    sglyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdG (G:)
    yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf
    sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlrgpksspkvtvfp
    pspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskqgqnymtssylsl
    tadqwkshnrvscqvthegetvekslspaecl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdH (H:)
    evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
    eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
    atttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlh
    sglyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr