PDB entry 1nfb

View 1nfb on RCSB PDB site
Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with 6Cl-IMP and NAD
Class: oxidoreductase
Keywords: 8 stranded paralle alpha/beta barrel, dehydrogenase, impd, impdh, guanine nucleotide biosynthesis nad, oxidoreductase
Deposited on 2002-12-13, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: -1.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5'-monophosphate dehydrogenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IMPDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nfba1, d1nfba4
  • Chain 'B':
    Compound: Inosine-5'-monophosphate dehydrogenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IMPDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nfbb1, d1nfbb4
  • Heterogens: CPR, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nfbA (A:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdcfleeimt
    kredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfbA (A:)
    tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
    mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvlspgipitd
    tgrmgsapagitlkeaneilqrskkgklpivneddevaiianrdyplaskdakkqllcga
    aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
    qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
    nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmdkgsihkfvpylia
    giqhscqdigaksltqvrammysgelkfekrtssaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nfbB (B:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdcfleeimt
    kredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfbB (B:)
    tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
    mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvlspgipitd
    tgrmgsapagitlkeaneilqrskkgklpivneddevaiianrdyplaskdakkqllcga
    aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
    qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
    nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmdkgsihkfvpylia
    giqhscqdigaksltqvrammysgelkfekrtssaq