PDB entry 1nfa

View 1nfa on RCSB PDB site
Description: human transcription factor nfatc DNA binding domain, nmr, 10 structures
Class: transcription regulation
Keywords: nfat, transcription regulation, rel-homology fold, activates cytokine transcription
Deposited on 1997-01-18, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human transcription factor nfatc1
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nfaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nfaA (A:)
mkdwqlpshsgpyelrievqpkshhrahyetegsrgavkasagghpivqlhgyleneplm
lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs