PDB entry 1nf7

View 1nf7 on RCSB PDB site
Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with Ribavirin Monophosphate and C2-Mycophenolic Adenine Dinucleotide
Deposited on 2002-12-13, released 2004-01-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.238
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nf7A (A:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdcfleeimt
    kredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf7A (A:)
    tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
    mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvlspkgiiss
    rdidflehdcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiia
    rtlkknrdyplaskdakkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqi
    nmikyikdkypnlqviggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqa
    tavykvseyarrfgvpviadggiqnvghiakalalgastvmmgsllaatteapgeyffsd
    girlkkyrgmgsldamikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nf7B (B:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdcfleeimt
    kredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf7B (B:)
    tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
    mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvlspkgiiss
    rdidflehdcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiia
    rtlkknrdyplaskdakkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqi
    nmikyikdkypnlqviggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqa
    tavykvseyarrfgvpviadggiqnvghiakalalgastvmmgsllaatteapgeyffsd
    girlkkyrgmgsldamikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf