PDB entry 1nf6

View 1nf6 on RCSB PDB site
Description: X-ray structure of the Desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation)
Class: iron storage/electron transport
Keywords: bacterioferritin, 24 subunits in the active molecule, diiron centre, haem Fe-Coproporphyrin III cofactor, IRON STORAGE-ELECTRON TRANSPORT COMPLEX
Deposited on 2002-12-13, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6b_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6c_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6d_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6e_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6f_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6g_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6h_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6i_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6j_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6k_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6l_
  • Chain 'M':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6m_
  • Chain 'N':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6n_
  • Chain 'O':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6o_
  • Chain 'P':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf6p_
  • Heterogens: FE, SO4, FEC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nf6A (A:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6A (A:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nf6B (B:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6B (B:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nf6C (C:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6C (C:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nf6D (D:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6D (D:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nf6E (E:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6E (E:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nf6F (F:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6F (F:)
    agnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhae
    nfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivt
    arlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nf6G (G:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6G (G:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nf6H (H:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6H (H:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1nf6I (I:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6I (I:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1nf6J (J:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6J (J:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1nf6K (K:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6K (K:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nf6L (L:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6L (L:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1nf6M (M:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6M (M:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nf6N (N:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6N (N:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1nf6O (O:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6O (O:)
    redrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenfa
    erikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtarl
    feriieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvt
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1nf6P (P:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf6P (P:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv