PDB entry 1nf4

View 1nf4 on RCSB PDB site
Description: X-Ray Structure of the Desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure)
Class: iron storage/electron transport
Keywords: bacterioferritin, active as 24-mer, diiron centre, Fe-coproporphyrin III haem cofactor
Deposited on 2002-12-13, released 2003-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.231
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4b_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4c_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4d_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4e_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4f_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4g_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4h_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4i_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4j_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4k_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4l_
  • Chain 'M':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4m_
  • Chain 'N':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4n_
  • Chain 'O':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4o_
  • Chain 'P':
    Compound: bacterioferritin
    Species: Desulfovibrio desulfuricans
    Database cross-references and differences (RAF-indexed):
    • GB AAK60120
    Domains in SCOP 1.75: d1nf4p_
  • Heterogens: FE2, SO4, FEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nf4A (A:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4A (A:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nf4B (B:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4B (B:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nf4C (C:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4C (C:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nf4D (D:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4D (D:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nf4E (E:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4E (E:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nf4F (F:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4F (F:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nf4G (G:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4G (G:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nf4H (H:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4H (H:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1nf4I (I:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4I (I:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1nf4J (J:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4J (J:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1nf4K (K:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4K (K:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nf4L (L:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4L (L:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1nf4M (M:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4M (M:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nf4N (N:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4N (N:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1nf4O (O:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4O (O:)
    nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
    aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
    lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1nf4P (P:)
    magnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrha
    enfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdiv
    tarlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfvtatpaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf4P (P:)
    gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
    faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
    rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv