PDB entry 1nf3

View 1nf3 on RCSB PDB site
Description: Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
Class: signaling protein
Keywords: semi-CRIB motif, Switch I and II, PDZ domain, GTPase binding domain, SIGNALING PROTEIN
Deposited on 2002-12-12, released 2003-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G25K GTP-binding protein, placental isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (5-End)
      • expression tag (0-4)
      • engineered (64)
    Domains in SCOPe 2.07: d1nf3a1, d1nf3a2
  • Chain 'B':
    Compound: G25K GTP-binding protein, placental isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (5-End)
      • expression tag (0-4)
      • engineered (64)
    Domains in SCOPe 2.07: d1nf3b1, d1nf3b2
  • Chain 'C':
    Compound: par-6b
    Species: Mus musculus [TaxId:10090]
    Gene: Par6B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf3c_
  • Chain 'D':
    Compound: par-6b
    Species: Mus musculus [TaxId:10090]
    Gene: Par6B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf3d_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nf3A (A:)
    gamgiqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
    dtagledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
    idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
    leppepkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf3A (A:)
    gamgiqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
    dtagledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
    idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
    leppepkksrrcvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nf3B (B:)
    gamgiqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
    dtagledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
    idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
    leppepkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf3B (B:)
    gamgiqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
    dtagledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
    idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
    leppepkksrrcvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nf3C (C:)
    rkkphivismpqdfrpvssiidvdilpethrrvrlckygtekplgfyirdgssvrvtphg
    lekvpgifisrlvpgglaqstgllavndevlevngievsgksldqvtdmmiansrnliit
    vrpanqrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf3C (C:)
    ivismpqdfrpvssiidvdilpethrrvrlckygtekplgfyirdgssvrvtphglekvp
    gifisrlvpgglaqstgllavndevlevngievsgksldqvtdmmiansrnliitvrpan
    qrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nf3D (D:)
    rkkphivismpqdfrpvssiidvdilpethrrvrlckygtekplgfyirdgssvrvtphg
    lekvpgifisrlvpgglaqstgllavndevlevngievsgksldqvtdmmiansrnliit
    vrpanqrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf3D (D:)
    ivismpqdfrpvssiidvdilpethrrvrlckygtekplgfyirdgssvrvtphglekvp
    gifisrlvpgglaqstgllavndevlevngievsgksldqvtdmmiansrnliitvrpan
    qrn