PDB entry 1nf2

View 1nf2 on RCSB PDB site
Description: X-ray crystal structure of TM0651 from Thermotoga maritima
Class: Structural genomics/Unknown function
Keywords: Thermotoga maritima, Structural proteomics, phosphatase, HAD family, New fold, Structural genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, Structural genomics-Unknown function COMPLEX
Deposited on 2002-12-12, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf2a_
  • Chain 'B':
    Compound: phosphatase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf2b_
  • Chain 'C':
    Compound: phosphatase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nf2c_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nf2A (A:)
    myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
    ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
    syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
    yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
    asdivtltnndsgvsyvleristdclde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf2A (A:)
    myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
    ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
    syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
    yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
    asdivtltnndsgvsyvleristdcld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nf2B (B:)
    myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
    ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
    syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
    yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
    asdivtltnndsgvsyvleristdclde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf2B (B:)
    myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
    ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
    syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
    yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
    asdivtltnndsgvsyvleristdcld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nf2C (C:)
    myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
    ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
    syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
    yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
    asdivtltnndsgvsyvleristdclde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nf2C (C:)
    myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
    ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
    syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
    yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
    asdivtltnndsgvsyvleristdcld