PDB entry 1nez

View 1nez on RCSB PDB site
Description: The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity
Deposited on 2002-12-12, released 2003-04-08
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nezA (A:)
    gshslryfytalsrpaisepwyiavgylddtqfarfdsagetgtyklsapwveqegpeyw
    areteivtsnaqffrenlqtmldyynlsqngshtiqvmygceveffgslfrayeqhgydg
    qdyialnedlktwtaadmaaeitrskweqagytelrrtylegpckdsllrylenrkktqe
    ctdppkthvthharpegdvtlrcwalgfypahitltwqlngeeliqdtelvetrpagdgt
    fqkwaavvvpsgeeqkytchvyheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nezB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nezG (G:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssalvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nezG (G:)
    apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
    twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
    sa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nezH (H:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssalvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nezH (H:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq