PDB entry 1ney

View 1ney on RCSB PDB site
Description: Triosephosphate Isomerase in Complex with DHAP
Class: isomerase
Keywords: yeast, triosephosphate isomerase, DHAP, dihydroxyacetone phosphate, michaelis complex
Deposited on 2002-12-12, released 2003-01-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.125
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00942 (0-246)
      • engineered (88)
      • engineered (155)
      • engineered (166)
    Domains in SCOPe 2.01: d1neya_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00942 (0-246)
      • engineered (88)
      • engineered (155)
      • engineered (166)
    Domains in SCOPe 2.01: d1neyb_
  • Heterogens: 13P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1neyA (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1neyB (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn