PDB entry 1neq

View 1neq on RCSB PDB site
Description: solution structure of the mu ner protein by multidimensional nmr
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1995-08-24, released 1995-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 1995-12-07, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein ner
    Species: Bacteriophage Mu
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1neqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1neqA (A:)
csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet
kpeviwpsryqage