PDB entry 1nep

View 1nep on RCSB PDB site
Description: crystal structure analysis of the bovine npc2 (niemann-pick c2) protein
Deposited on 2002-12-11, released 2003-01-28
The last revision prior to the SCOP 1.71 freeze date was dated 2003-03-11, with a file datestamp of 2003-03-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1nepa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nepA (A:)
    epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
    gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
    cwqipievea