PDB entry 1neg

View 1neg on RCSB PDB site
Description: crystal structure analysis of n-and c-terminal labeled sh3-domain of alpha-chicken spectrin
Deposited on 2002-12-11, released 2003-01-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1nega_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1negA (A:)
    mrgshhhhhhgsdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndr
    qgfvpaayvkklaaawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1negA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkklaaaw
    shpqf