PDB entry 1neg

View 1neg on RCSB PDB site
Description: Crystal Structure Analysis of N-and C-terminal labeled SH3-domain of alpha-Chicken Spectrin
Class: structural protein
Keywords: SH3-domain fold, five antiparallel beta sheets, STRUCTURAL PROTEIN
Deposited on 2002-12-11, released 2003-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (Start-71)
      • see remark 999 (72-80)
    Domains in SCOPe 2.07: d1nega1, d1nega2
  • Heterogens: AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1negA (A:)
    mrgshhhhhhgsdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndr
    qgfvpaayvkklaaawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1negA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkklaaaw
    shpqf