PDB entry 1nee

View 1nee on RCSB PDB site
Description: Structure of archaeal translation factor aIF2beta from Methanobacterium thermoautrophicum
Class: translation
Keywords: two domain protein, mixed alpha-beta structure, Zinc finger, TRANSLATION
Deposited on 2002-12-11, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable translation initiation factor 2 beta subunit
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH1769
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1neea1, d1neea2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1neeA (A:)
gshmddyeklleraidqlppevfetkrfevpkaysviqgnrtfiqnfrevadalnrdpqh
llkfllrelgtagnleggrailqgkfthflineriedyvnkfvichecnrpdtriiregr
isllkceacgakaplknv

    Sequence, based on observed residues (ATOM records): (download) 
    >1neeA (A:)
mddyeklleraidqlppevfetkrfevpkaysviqgnrtfiqnfrevadalnrdpqhllk
fllrelgtagnleggrailqgkfthflineriedyvnkfvichecnrpdtriiregrisl
lkceacgakaplknv