PDB entry 1ned

View 1ned on RCSB PDB site
Description: crystal structure of hslv (clpq) at 3.8 angstroms resolution
Class: hydrolase
Keywords: hslv, clpq, hslvu, clpqy, ATP-dependent protease, proteasome, hydrolase
Deposited on 1997-04-04, released 1998-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 1998-04-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.256
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1neda_
  • Chain 'B':
    Compound: hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nedb_
  • Chain 'C':
    Compound: hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nedc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nedA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nedA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nedB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nedB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
    h
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nedC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nedC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
    h