PDB entry 1neb

View 1neb on RCSB PDB site
Description: sh3 domain from human nebulin, nmr, minimized average structure
Class: sh3 domain
Keywords: sh3 domain, nebulin, z-disk assembly, actin-binding
Deposited on 1997-08-07, released 1997-12-24
The last revision prior to the SCOP 1.75 freeze date was dated 1997-12-24, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nebulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1neba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nebA (A:)
    tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai