PDB entry 1nea

View 1nea on RCSB PDB site
Description: three-dimensional solution structure of a curaremimetic toxin from naja nigricollis venom: a proton nmr and molecular modeling study
Class: toxin
Keywords: toxin
Deposited on 1992-09-22, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toxin alpha
  Species: Naja nigricollis [TaxId:8654]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01426 (0-60)
  Domains in SCOPe 2.08: d1neaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1neaA (A:)
  lechnqqssqppttktcpgetncykkvwrdhrgtiiergcgcptvkpgiklnccttdkcn
  n