PDB entry 1ne9

View 1ne9 on RCSB PDB site
Description: Crystal Structure of Weissella viridescens FemX at 1.7 Ang Resolution
Class: ligase
Keywords: protein, LIGASE
Deposited on 2002-12-11, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FemX
    Species: Weissella viridescens [TaxId:1629]
    Gene: femx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ne9a1, d1ne9a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ne9A (A:)
    pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
    lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
    lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldlypsktkskikrpfrdg
    vevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafdadtmrifvaeregkll
    stgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtntdlydlggiesestdds
    lyvfkhvfvkdapreyigeidkvldpevyaelvkd