PDB entry 1ne7

View 1ne7 on RCSB PDB site
Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino-glucitol-6-phosphate
Class: hydrolase
Keywords: v-type like allosteric enzyme, conformational disorder, conformational differences, hydrolase
Deposited on 2002-12-10, released 2003-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucosamine-6-phosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNPI OR HLN OR KIAA0060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ne7a_
  • Chain 'B':
    Compound: Glucosamine-6-phosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNPI OR HLN OR KIAA0060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ne7b_
  • Chain 'C':
    Compound: Glucosamine-6-phosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNPI OR HLN OR KIAA0060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ne7c_
  • Chain 'D':
    Compound: Glucosamine-6-phosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNPI OR HLN OR KIAA0060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ne7d_
  • Chain 'E':
    Compound: Glucosamine-6-phosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNPI OR HLN OR KIAA0060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ne7e_
  • Chain 'F':
    Compound: Glucosamine-6-phosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNPI OR HLN OR KIAA0060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ne7f_
  • Heterogens: GLC, 16G, SO4, AGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ne7A (A:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne7A (A:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ne7B (B:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne7B (B:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ne7C (C:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne7C (C:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ne7D (D:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne7D (D:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ne7E (E:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne7E (E:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ne7F (F:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne7F (F:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike