PDB entry 1ne5

View 1ne5 on RCSB PDB site
Description: Solution Structure of HERG Specific Scorpion Toxin CnErg1
Class: toxin
Keywords: alpha-helix, triple-stranded beta-sheet, TOXIN
Deposited on 2002-12-10, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ergtoxin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ne5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ne5A (A:)
    drdscvdksrcakygyyqecqdccknaghnggtcmffkckca