PDB entry 1ne4

View 1ne4 on RCSB PDB site
Description: Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
Class: hydrolase
Keywords: cAMP-dependent protein kinase, R1a subunit, cAMP analog, Rp-cAMP, crystal structure, HYDROLASE
Deposited on 2002-12-10, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory chain
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ne4a1, d1ne4a2
  • Heterogens: RP1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ne4A (A:)
    rrgaisaevyteedaasyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfp
    vsfiagetviqqgdegdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatv
    kaktnvklwgidrdsyrrilmgstlrkrkmyeeflskvsilesldkwerltvadalepvq
    fedgqkivvqgepgdeffiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnrpr
    aatvvargplkcvkldrprfervlgpcsdilkrniqqynsfvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ne4A (A:)
    asyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgde
    gdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrds
    yrrilmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgd
    effiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkl
    drprfervlgpcsdilkrniqqynsfvs