PDB entry 1ne3

View 1ne3 on RCSB PDB site
Description: Solution structure of ribosomal protein S28E from Methanobacterium Thermoautotrophicum. Ontario Centre for Structural Proteomics target MTH0256_1_68; Northeast Structural Genomics Target TT744
Class: ribosome
Keywords: Beta protein, structural genomics, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI, Northeast Structural Genomics Consortium, RIBOSOME
Deposited on 2002-12-10, released 2003-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S28E
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ne3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ne3A (A:)
    mddatpaevievlkrtgmtgevmqvkcrildgrdkgriltrnvmgpiregdilmlldtir
    eakeirtp