PDB entry 1ne3

View 1ne3 on RCSB PDB site
Description: solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
Deposited on 2002-12-10, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1ne3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ne3A (A:)
  mddatpaevievlkrtgmtgevmqvkcrildgrdkgriltrnvmgpiregdilmlldtir
  eakeirtp