PDB entry 1ndu

View 1ndu on RCSB PDB site
Description: Bacillus lentus subtilisin variant S101G/V104N
Class: hydrolase
Keywords: Subtilisin, Protease, HYDROLASE
Deposited on 2002-12-09, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subtilisin Savinase
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29600 (0-268)
      • see remark 999 (84)
      • engineered (98)
      • engineered (101)
    Domains in SCOPe 2.07: d1ndua_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nduA (A:)
    aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
    ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgggsnssiaqglewagnngmhva
    nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
    asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
    rnhlkntatslgstnlygsglvnaeaatr