PDB entry 1ndt

View 1ndt on RCSB PDB site
Description: nitrite reductase from alcaligenes xylosoxidans
Class: oxidoreductase
Keywords: nitrite reductase, blue copper, oxidoreductase
Deposited on 1998-10-28, released 1998-11-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nitrite reductase)
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ndta1, d1ndta2
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndtA (A:)
    adadslphtkvtlvappqvhpheqatasgpkvteftmtieekkmviddsgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapsgmvpwhvvsgmsgtlmvlprdglkdpagaplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltasvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghisvegkwnddlmkqikapapipa