PDB entry 1ndt

View 1ndt on RCSB PDB site
Description: nitrite reductase from alcaligenes xylosoxidans
Class: oxidoreductase
Keywords: nitrite reductase, copper, blue copper
Deposited on 1998-10-28, released 1998-11-04
The last revision prior to the SCOP 1.75 freeze date was dated 1999-12-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nitrite reductase)
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ndta1, d1ndta2
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndtA (A:)
    adadslphtkvtlvappqvhpheqatasgpkvteftmtieekkmviddsgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapsgmvpwhvvsgmsgtlmvlprdglkdpagaplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltasvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghisvegkwnddlmkqikapapipa