PDB entry 1nds

View 1nds on RCSB PDB site
Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans
Class: reductase
Keywords: blue copper nitrite reductase, copper protein, nitrite reduction, reductase
Deposited on 1997-01-23, released 1997-07-07
The last revision prior to the SCOP 1.75 freeze date was dated 1997-07-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81445 (0-328)
      • conflict (2)
      • conflict (5)
      • conflict (18)
      • conflict (21-22)
      • conflict (24)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (109)
      • conflict (128)
      • conflict (154-155)
      • conflict (157-158)
      • conflict (160)
      • conflict (174)
      • conflict (177-178)
      • conflict (181)
      • conflict (183)
      • conflict (187)
      • conflict (191)
      • conflict (193)
      • conflict (196)
      • conflict (207)
      • conflict (212)
      • conflict (224-225)
      • conflict (232)
      • conflict (265)
      • conflict (278)
      • conflict (291)
      • conflict (306)
      • conflict (309-310)
      • conflict (322)
      • conflict (324)
    Domains in SCOP 1.75: d1ndsa1, d1ndsa2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81445 (0-328)
      • conflict (2)
      • conflict (5)
      • conflict (18)
      • conflict (21-22)
      • conflict (24)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (109)
      • conflict (128)
      • conflict (154-155)
      • conflict (157-158)
      • conflict (160)
      • conflict (174)
      • conflict (177-178)
      • conflict (181)
      • conflict (183)
      • conflict (187)
      • conflict (191)
      • conflict (193)
      • conflict (196)
      • conflict (207)
      • conflict (212)
      • conflict (224-225)
      • conflict (232)
      • conflict (265)
      • conflict (278)
      • conflict (291)
      • conflict (306)
      • conflict (309-310)
      • conflict (322)
      • conflict (324)
    Domains in SCOP 1.75: d1ndsb1, d1ndsb2
  • Chain 'C':
    Compound: nitrite reductase
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81445 (0-328)
      • conflict (2)
      • conflict (5)
      • conflict (18)
      • conflict (21-22)
      • conflict (24)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (109)
      • conflict (128)
      • conflict (154-155)
      • conflict (157-158)
      • conflict (160)
      • conflict (174)
      • conflict (177-178)
      • conflict (181)
      • conflict (183)
      • conflict (187)
      • conflict (191)
      • conflict (193)
      • conflict (196)
      • conflict (207)
      • conflict (212)
      • conflict (224-225)
      • conflict (232)
      • conflict (265)
      • conflict (278)
      • conflict (291)
      • conflict (306)
      • conflict (309-310)
      • conflict (322)
      • conflict (324)
    Domains in SCOP 1.75: d1ndsc1, d1ndsc2
  • Heterogens: CU, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndsA (A:)
    glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
    ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
    tfvyhcapagmvpwhvvsgmngalmvlprdglrdaagaalaydrvytigesdlyvpkaad
    gnysdypalasayadtvavmrtltpshavfngavgaltganaltaavgesvliihsqanr
    dsrphligghgdwvwttgkfanppqlnmetwfipggsaaaalytfkqpgtyaylshnlie
    amelgaaaqasvegqwdddlmtsvaapgpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndsB (B:)
    glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
    ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
    tfvyhcapagmvpwhvvsgmngalmvlprdglrdaagaalaydrvytigesdlyvpkaad
    gnysdypalasayadtvavmrtltpshavfngavgaltganaltaavgesvliihsqanr
    dsrphligghgdwvwttgkfanppqlnmetwfipggsaaaalytfkqpgtyaylshnlie
    amelgaaaqasvegqwdddlmtsvaapgpa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndsC (C:)
    glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
    ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
    tfvyhcapagmvpwhvvsgmngalmvlprdglrdaagaalaydrvytigesdlyvpkaad
    gnysdypalasayadtvavmrtltpshavfngavgaltganaltaavgesvliihsqanr
    dsrphligghgdwvwttgkfanppqlnmetwfipggsaaaalytfkqpgtyaylshnlie
    amelgaaaqasvegqwdddlmtsvaapgpa