PDB entry 1ndr

View 1ndr on RCSB PDB site
Description: crystallographic structure of a blue copper nitrite reductase from alcaligenes xylosoxidans
Class: reductase
Keywords: blue copper nitrite reductase, copper protein, nitrite reduction, reductase
Deposited on 1997-01-23, released 1997-07-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81445 (0-328)
      • conflict (2)
      • conflict (5)
      • conflict (18)
      • conflict (21-22)
      • conflict (24)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (109)
      • conflict (128)
      • conflict (154-155)
      • conflict (157-158)
      • conflict (160)
      • conflict (174)
      • conflict (177-178)
      • conflict (181)
      • conflict (183)
      • conflict (187)
      • conflict (191)
      • conflict (193)
      • conflict (196)
      • conflict (207)
      • conflict (212)
      • conflict (224-225)
      • conflict (232)
      • conflict (265)
      • conflict (278)
      • conflict (291)
      • conflict (306)
      • conflict (309-310)
      • conflict (322)
      • conflict (324)
    Domains in SCOPe 2.02: d1ndra1, d1ndra2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81445 (0-328)
      • conflict (2)
      • conflict (5)
      • conflict (18)
      • conflict (21-22)
      • conflict (24)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (109)
      • conflict (128)
      • conflict (154-155)
      • conflict (157-158)
      • conflict (160)
      • conflict (174)
      • conflict (177-178)
      • conflict (181)
      • conflict (183)
      • conflict (187)
      • conflict (191)
      • conflict (193)
      • conflict (196)
      • conflict (207)
      • conflict (212)
      • conflict (224-225)
      • conflict (232)
      • conflict (265)
      • conflict (278)
      • conflict (291)
      • conflict (306)
      • conflict (309-310)
      • conflict (322)
      • conflict (324)
    Domains in SCOPe 2.02: d1ndrb1, d1ndrb2
  • Chain 'C':
    Compound: nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81445 (0-328)
      • conflict (2)
      • conflict (5)
      • conflict (18)
      • conflict (21-22)
      • conflict (24)
      • conflict (41)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (109)
      • conflict (128)
      • conflict (154-155)
      • conflict (157-158)
      • conflict (160)
      • conflict (174)
      • conflict (177-178)
      • conflict (181)
      • conflict (183)
      • conflict (187)
      • conflict (191)
      • conflict (193)
      • conflict (196)
      • conflict (207)
      • conflict (212)
      • conflict (224-225)
      • conflict (232)
      • conflict (265)
      • conflict (278)
      • conflict (291)
      • conflict (306)
      • conflict (309-310)
      • conflict (322)
      • conflict (324)
    Domains in SCOPe 2.02: d1ndrc1, d1ndrc2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndrA (A:)
    glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
    ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
    tfvyhcapagmvpwhvvsgmngalmvlprdglrdaagaalaydrvytigesdlyvpkaad
    gnysdypalasayadtvavmrtltpshavfngavgaltganaltaavgesvliihsqanr
    dsrphligghgdwvwttgkfanppqlnmetwfipggsaaaalytfkqpgtyaylshnlie
    amelgaaaqasvegqwdddlmtsvaapgpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndrB (B:)
    glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
    ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
    tfvyhcapagmvpwhvvsgmngalmvlprdglrdaagaalaydrvytigesdlyvpkaad
    gnysdypalasayadtvavmrtltpshavfngavgaltganaltaavgesvliihsqanr
    dsrphligghgdwvwttgkfanppqlnmetwfipggsaaaalytfkqpgtyaylshnlie
    amelgaaaqasvegqwdddlmtsvaapgpa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndrC (C:)
    glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
    ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
    tfvyhcapagmvpwhvvsgmngalmvlprdglrdaagaalaydrvytigesdlyvpkaad
    gnysdypalasayadtvavmrtltpshavfngavgaltganaltaavgesvliihsqanr
    dsrphligghgdwvwttgkfanppqlnmetwfipggsaaaalytfkqpgtyaylshnlie
    amelgaaaqasvegqwdddlmtsvaapgpa