PDB entry 1ndl

View 1ndl on RCSB PDB site
Description: the awd nucleotide diphosphate kinase from drosophila
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1993-11-27, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ndla_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ndlb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ndlc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ndlA (A:)
    maankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarp
    ffpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihg
    sdavesaekeialwfnekelvtwtpaakdwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndlA (A:)
    aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf
    fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs
    davesaekeialwfnekelvtwtpaakdwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ndlB (B:)
    maankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarp
    ffpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihg
    sdavesaekeialwfnekelvtwtpaakdwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndlB (B:)
    aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf
    fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs
    davesaekeialwfnekelvtwtpaakdwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ndlC (C:)
    maankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarp
    ffpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihg
    sdavesaekeialwfnekelvtwtpaakdwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndlC (C:)
    aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf
    fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs
    davesaekeialwfnekelvtwtpaakdwiye