PDB entry 1ndk

View 1ndk on RCSB PDB site
Description: x-ray structure of nucleoside diphosphate kinase
Class: transferase
Keywords: transferase
Deposited on 1993-07-15, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • conflict (121)
    Domains in SCOPe 2.06: d1ndka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ndkA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    icgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndkA (A:)
    kertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffgg
    lvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniicgsdsv
    esanreialwfkpeelltevkpnpnlye