PDB entry 1ndi

View 1ndi on RCSB PDB site
Description: Carnitine Acetyltransferase in complex with CoA
Class: transferase
Keywords: acetyl transfer, CoA, coenzyme A, TRANSFERASE
Deposited on 2002-12-09, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.27
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carnitine acetyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ndia1, d1ndia2
  • Chain 'B':
    Compound: carnitine acetyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ndib1, d1ndib2
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndiA (A:)
    ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
    rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
    ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
    qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
    kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
    ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
    kndiekakqnlsimiqdldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqac
    atyesaslrmfhlgrtdtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdr
    airgeafdrhllglklqaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmffgpv
    vpdgygicynpmeahinfsvsaynscaetnaarmahylekalldmrtllqnhprak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ndiB (B:)
    ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
    rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
    ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
    qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
    kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
    ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
    kndiekakqnlsimiqdldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqac
    atyesaslrmfhlgrtdtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdr
    airgeafdrhllglklqaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmffgpv
    vpdgygicynpmeahinfsvsaynscaetnaarmahylekalldmrtllqnhprak