PDB entry 1nde

View 1nde on RCSB PDB site
Description: Estrogen Receptor beta with Selective Triazine Modulator
Class: transcription
Keywords: estrogen receptor, estrogen receptor beta, ER, ERb, triazine, estrogen, estradiol, oestrogen, TRANSCRIPTION
Deposited on 2002-12-09, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ndea_
  • Heterogens: MON, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ndeA (A:)
    mkkhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkel
    vhmiswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrde
    gkcvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrkl
    ahllnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvp
    vydlllemlnahvlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndeA (A:)
    dalspeqlvltlleaepphvlisrpsfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyatqdadssrklahllnavtdalvwviaksgi
    ssqqqsmrlanllmllshvrhasnkgmehllnmkckpvydlllemlnahvl