PDB entry 1ndd

View 1ndd on RCSB PDB site
Description: structure of nedd8
Deposited on 1998-08-21, released 1999-02-23
The last revision prior to the SCOP 1.69 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.219
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ndda_
  • Chain 'B':
    Domains in SCOP 1.69: d1nddb_
  • Chain 'C':
    Domains in SCOP 1.69: d1nddc_
  • Chain 'D':
    Domains in SCOP 1.69: d1nddd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nddA (A:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nddA (A:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nddB (B:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nddC (C:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nddC (C:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nddD (D:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nddD (D:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlal