PDB entry 1nd7

View 1nd7 on RCSB PDB site
Description: Conformational Flexibility Underlies Ubiquitin Ligation Mediated by the WWP1 HECT domain E3 Ligase
Class: ligase
Keywords: HECT, Ubiquitin, Ligase, E3, WWP1
Deposited on 2002-12-08, released 2003-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.243
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WW domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: WWP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0M0 (2-373)
      • expression tag (0)
      • initiator methionine (1)
    Domains in SCOPe 2.06: d1nd7a1, d1nd7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd7A (A:)
    hmgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrge
    egldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrf
    iamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemy
    fsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnev
    vplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevr
    mrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksye
    qlkekllfaieete