PDB entry 1nd1

View 1nd1 on RCSB PDB site
Description: amino acid sequence and crystal structure of bap1, a metalloproteinase from bothrops asper snake venom that exerts multiple tissue-damaging activities.
Deposited on 2002-12-06, released 2003-11-04
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1nd1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd1A (A:)
    erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
    kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
    hsvgvvrdhsknnlwvavtmahelghnlgidhdtgscscgakscimasvlskvlsyefsd
    csqnqyetyltnhnpqcilnkp