PDB entry 1nd1

View 1nd1 on RCSB PDB site
Description: Amino acid sequence and crystal structure of BaP1, a metalloproteinase from Bothrops asper snake venom that exerts multiple tissue-damaging activities.
Class: toxin
Keywords: metalloproteinase, snake venom, three-disulfide, TOXIN
Deposited on 2002-12-06, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BaP1
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nd1a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd1A (A:)
    erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
    kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
    hsvgvvrdhsknnlwvavtmahelghnlgidhdtgscscgakscimasvlskvlsyefsd
    csqnqyetyltnhnpqcilnkp